HORDB

ID: hor006065
Uniprot ID: Q9QXU9
Protein name: Little LEN
Gene name: Pcsk1n
Organism: Rattus norvegicus (Rat)
Family: NA
Source: animal
Expression: Expressed by 12.5 dpc in essentially all differentiating neurons in the mantle layer of the myelencephalon, metencephalon, diencephalon, spinal cord and several sympathetic ganglia. During later stages of prenatal development, widespread expression contin
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0004866 endopeptidase inhibitor activity; GO:0004867 serine-type endopeptidase inhibitor activity
GO BP: GO:0002021 response to dietary excess; GO:0007218 neuropeptide signaling pathway; GO:0009409 response to cold; GO:0016486 peptide hormone processing
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005794 Golgi apparatus; GO:0005802 trans-Golgi network; GO:0030141 secretory granule

Sequence: LENSSPQAPA
Length: 10(245-254)
Propeptide: MAGSPLLCGPRAGGVGLLVLLLLGLLRLPPTLSARPVKEPRSLSAASAPLAETSTPLRLRRAVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRAWGSPRASDPPLAPDDDPDAPAAQLARALLRARLDPAALAAQLVPAPAPAAALRPRPPVYDDGPTGPDVEDAADETPDVDPELLRYLLGRILTGSSEPEAAPAPRRLRRAVDQDLGPEVPPENVLGALLRVKRLENSSPQAPAR
Signal peptide: MAGSPLLCGPRAGGVGLLVLLLLGLLRLPPTLS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: May function in the control of the neuroendocrine secretory pathway. Proposed be a specific endogenous inhibitor of PCSK1 (PubMed:10632593, PubMed:10816562). ProSAAS and Big PEN-LEN, both containing the C-terminal inhibitory domain, but not the processed
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006065_AF2.pdb

hor006065_ESM.pdb

Mass:	117378	Formula:	C42H68N12O17
Absent amino acids:	CDFGHIKMRTVWY	Common amino acids:	APS
pI:	3.85	Basic residues:	0
Polar residues:	3	Hydrophobic residues:	3
Hydrophobicity:	-79	Boman Index:	-1725
Half-Life:	5.5 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	59
Instability Index:	12908	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 10632593
Title: Identification and characterization of proSAAS, a granin-like neuroendocrine peptide precursor that inhibits prohormone processing.
PubMed ID: 9630436
Title: Molecular cloning and characterization of a highly basic protein, IA-4, expressed in pancreatic islets and brain.
PubMed ID: 10816562
Title: The C-t
PubMed ID: 11742530
Title:
PubMed ID: 15935061
Title: